MOTS-c is a research peptide with the amino acid sequence MITQTPLKEEELKDAFASVSEEMNELRKKDKMM, corresponding to a molar mass of approximately 1737.02 g/mol. This peptide is characterized by a high purity level, typically exceeding 98% as confirmed by HPLC, and is commonly provided as a white, lyophilized powder. For laboratory handling, MOTS-c is recommended to be stored at -20°C to maintain its stability and integrity, with a Certificate of Analysis provided for each lot to ensure the quality and authenticity of the material.
Chemical Identity and Classification
MOTS-c belongs to the class of peptides, which are short chains of amino acids linked by peptide bonds. Its chemical structure is composed of 16 amino acid residues, with a molecular formula of C₇₅H₁₂₁N₂₃O₂₄S. The peptide’s structure and properties make it an interesting subject for in-vitro studies, allowing researchers to explore its characteristics and potential applications in a controlled laboratory setting.
Molecular and Structural Properties
The molecular weight of MOTS-c is approximately 1737.02 g/mol, and its isoelectric point is around 10.5. The peptide’s secondary structure is characterized by the presence of alpha-helices and beta-sheets, which contribute to its stability and folding. MOTS-c’s solubility in water is relatively high, making it suitable for in-vitro experiments and analysis. Researchers can obtain research-grade MOTS-c from suppliers like research-grade compounds at Alpha Amino, ensuring the quality and authenticity of the material.
Physical Characteristics and Handling
MOTS-c is typically provided as a white, lyophilized powder, which is stable at room temperature for short periods. However, for long-term storage, it is recommended to keep the peptide at -20°C to maintain its stability and prevent degradation. When handling MOTS-c, researchers should follow standard aseptic laboratory techniques, using sterile equipment and pipetting procedures to minimize contamination and ensure accurate results. The peptide’s solubility in water and other solvents makes it suitable for in-vitro experiments, allowing researchers to prepare stock solutions and perform analysis.
Purity and Quality Verification
The purity of MOTS-c is typically verified using HPLC, with a minimum purity level of 98% required for research-grade material. Additionally, mass spectrometry is used to confirm the peptide’s identity and structure, ensuring that the material is authentic and consistent. A Certificate of Analysis is provided for each lot of MOTS-c, detailing the peptide’s purity, molecular weight, and other relevant characteristics. Researchers can verify the quality of the material by reviewing the Certificate of Analysis and ensuring that the supplier provides transparent and accurate information about the peptide.
Selecting and Verifying a Research-Grade Source
When selecting a supplier for research-grade MOTS-c, researchers should look for a reputable source that provides a per-lot Certificate of Analysis, HPLC purity confirmation, and mass spectrometry identity verification. Alpha Amino, a US-based supplier, offers research-grade MOTS-c with a Certificate of Analysis and transparent lot numbers, ensuring the quality and authenticity of the material. Researchers should also consider the supplier’s reputation, experience, and commitment to providing high-quality research materials. By verifying the quality and authenticity of the peptide, researchers can ensure accurate and reliable results in their in-vitro experiments.
Storage and Stability for Laboratory Handling
MOTS-c is recommended to be stored at -20°C to maintain its stability and integrity. The peptide’s lyophilized powder form is stable at room temperature for short periods, but long-term storage at -20°C is necessary to prevent degradation. Researchers should follow standard laboratory handling procedures, using sterile equipment and pipetting techniques to minimize contamination and ensure accurate results. By storing the peptide properly and handling it with care, researchers can ensure the quality and stability of the material for their in-vitro experiments.
Frequently asked questions
What is the molecular weight of MOTS-c?
The molecular weight of MOTS-c is approximately 1737.02 g/mol. This value is confirmed by mass spectrometry and is an important characteristic of the peptide.
How do I store MOTS-c for laboratory handling?
MOTS-c should be stored at -20°C to maintain its stability and integrity. The peptide’s lyophilized powder form is stable at room temperature for short periods, but long-term storage at -20°C is necessary to prevent degradation.
What is the purity level of research-grade MOTS-c?
The purity level of research-grade MOTS-c is typically exceeding 98%, as confirmed by HPLC. This high purity level ensures the quality and authenticity of the material for in-vitro experiments.
How can I verify the quality of MOTS-c from a supplier?
Researchers can verify the quality of MOTS-c by reviewing the Certificate of Analysis provided by the supplier, which details the peptide’s purity, molecular weight, and other relevant characteristics. Additionally, researchers should look for a reputable supplier that provides transparent and accurate information about the peptide.
Where can I purchase research-grade MOTS-c?
Research-grade MOTS-c can be purchased from reputable suppliers like Alpha Amino, which offers research-grade compounds with a Certificate of Analysis and transparent lot numbers, ensuring the quality and authenticity of the material.
Alpha Amino products are sold strictly for laboratory and research use only and are not intended for human or veterinary use, diagnosis, treatment, or consumption.
