FREE Shipping on domestic orders over 250+. USA-Domestic Delivery and same-day shipping We Deliver Internationally World Wide Independent Testing to meet quality standards Sales strictly limited to licensed research institutions and professionals.
FREE Shipping on domestic orders over 250+. USA-Domestic Delivery and same-day shipping We Deliver Internationally World Wide Independent Testing to meet quality standards Sales strictly limited to licensed research institutions and professionals.
FREE Shipping on domestic orders over 250+. USA-Domestic Delivery and same-day shipping We Deliver Internationally World Wide Independent Testing to meet quality standards Sales strictly limited to licensed research institutions and professionals.
FREE Shipping on domestic orders over 250+. USA-Domestic Delivery and same-day shipping We Deliver Internationally World Wide Independent Testing to meet quality standards Sales strictly limited to licensed research institutions and professionals.
Select category
  • Select category
  • Cellular Research Compounds
  • Endocrine Research Models
  • Metabolic Pathway Research
  • More
    • Accessories & Supplies
  • Neurochemical Research
  • Synergistic Formulas
  • System Regulation Research
  • Tissue Structure Research
Login / Register
Wishlist
0 items $0.00
Menu
Alpha Amino USA
0 items $0.00
  • Home
  • Cellular Research Compounds
  • Metabolic Pathway Research
  • System Regulation Research
  • Tissue Structure Research
  • Endocrine Research Models
  • Neurochemical Research
  • COA Library
  • More
    • Accessories & Supplies
    • Synergistic Formulas
  • About
  • Contact
  • Why Alpha Amino Uses Secure Payment Links (Not Standard Card Processing)
  • Research Library

Research Library

Uncategorized

Selank Research Compound: Specifications and Research-Grade Sourcing

Posted by author-avatar jaxiblog
July 20, 2026
Selank, also known as Selank research peptide, is a synthetic peptide with the amino acid sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, a molec...
Continue reading
Uncategorized

Semax Research Peptide: Molecular Properties and Quality Verification

Posted by author-avatar jaxiblog
July 18, 2026
Semax, a synthetic peptide with the amino acid sequence Met-Glu-His-Phe-Pro-Gly-Pro, has a molecular formula of C₃₁H₄₃N₉O₈ and a molar ...
Continue reading
Uncategorized

MOTS-c Research Peptide: Structure, Specifications, and Storage

Posted by author-avatar jaxiblog
July 14, 2026
MOTS-c is a research peptide with the amino acid sequence MITQTPLKEEELKDAFASVSEEMNELRKKDKMM, corresponding to a molar mass of approxima...
Continue reading
Uncategorized

How to Source Research-Grade TB-500: Quality Markers to Verify

Posted by author-avatar jaxiblog
July 12, 2026
TB-500, a synthetic peptide with the amino acid sequence of 28 residues, has a molecular formula of C₁₂₈H₂₄₉N₄₃O₄₆ and a molar mass of ...
Continue reading
Uncategorized

TB-500 Research Compound: Molecular Properties and Purity Standards

Posted by author-avatar jaxiblog
July 10, 2026
TB-500, a synthetic peptide with the amino acid sequence Ac-Ser-Asp-Lys-Pro-Met-Leu-Gln-Asp-Lys-Val, has a molecular formula of C₁₂₈H₂₄...
Continue reading
Uncategorized

How to Verify BPC-157 Quality and Certificate of Analysis

Posted by author-avatar jaxiblog
July 8, 2026
BPC-157, also known as Body Protection Compound 157, is a synthetic peptide with the amino acid sequence GEPPGDGAEGGPGPAG, a molar mass...
Continue reading
Uncategorized

BPC-157 Research Peptide: Composition and Laboratory Specifications

Posted by author-avatar jaxiblog
July 6, 2026
BPC-157, also known as Body Protection Compound 157, is a synthetic peptide composed of 15 amino acids with a molecular formula of C62H...
Continue reading
Uncategorized

GHK-Cu Storage, Stability, and In-Vitro Stock Preparation for Research

Posted by author-avatar jaxiblog
June 28, 2026
GHK-Cu, a tripeptide with the amino acid sequence Gly-His-Lys, has a molecular formula of C₁₄H₂₄N₆O₄Cu and a molar mass of approximatel...
Continue reading
Uncategorized

GHK-Cu Storage, Stability, and In-Vitro Stock Preparation for Research

Posted by author-avatar jaxiblog
June 28, 2026
GHK-Cu, a tripeptide with the amino acid sequence Gly-His-Lys, has a molecular formula of C₁₄H₂₄N₆O₄Cu and a molar mass of approximatel...
Continue reading
Uncategorized

How to Verify GHK-Cu Purity and Certificate of Analysis Before Buying

Posted by author-avatar jaxiblog
June 28, 2026
GHK-Cu, a tripeptide with the amino acid sequence Gly-His-Lys, has a molecular formula of C₁₄H₂₄N₆O₄Cu and a molar mass of approximatel...
Continue reading
  • ‹
  • 1
  • 2
  • 3
  • 4
  • ›
  • »

AlphaAmino is a supplier of laboratory research chemicals intended only for qualified scientific research.

Facebook Instagram X-twitter

Quick Links

  • Home
  • Shop All
  • About Us
  • Contact Us

Top Categories

  • Cellular Research Compounds
  • Endocrine Research Models
  • System Regulation Research
  • Tissue Structure Research
  • Neurochemical Research

Customer Care

  • Shipping Policy
  • Refund and Returns Policy
  • Privacy Policy
  • Terms & Conditions
  • Frequently Asked Questions

Contact Us

  • Mon – Fri 9:00 AM – 6:00 PM (EST)
  • [email protected]
  • Shipping Days: Mon – Fri (Business Days Only)

© 2025 Alpha Amino USA | All Rights Reserved.

All products on this site are for Research, Development use only. Products are Not for Human consumption of any kind.
The statements made within this website have not been evaluated by the US Food and Drug Administration. The statements and the products of this company are not intended to diagnose, treat, cure or prevent any disease.
 
 
Alpha Amino is a chemical supplier. Alpha Amino is not a compounding pharmacy or chemical compounding facility as defined under 503A of the Federal Food, Drug, and Cosmetic act. Alpha Amino USA  is not an outsourcing facility as defined under 503B of the Federal Food, Drug, and Cosmetic act

 

 

Close
  • Home
  • Cellular Research Compounds
  • Metabolic Pathway Research
  • System Regulation Research
  • Tissue Structure Research
  • Endocrine Research Models
  • Neurochemical Research
  • COA Library
  • More
    • Accessories & Supplies
    • Synergistic Formulas
  • About
  • Contact
  • Why Alpha Amino Uses Secure Payment Links (Not Standard Card Processing)
  • Research Library
  • Wishlist
  • Login / Register
Shopping cart
Close
Sign in
Close

Lost your password?

No account yet?

Create an Account

Are you over 21?

You must be 21 years of age or older to view page. Please verify your age to enter.

Disclaimer! All products are sold in powder (lyophilized) form and require reconstitution with a suitable diluent for research purposes only. Research supplies (e.g., syringes, bacteriostatic water) are not included. No dosing instructions are provided. We adhere to all local and state laws around Research Only Chemical sales. We are not a pharmacy, nor do we promote or provide any advice for human or animal consumption. Please review our terms and conditions carefully before making a purchase on our website. You must be 21+ and a licensed research professional By clicking "I Agree" you confirm that you have read and accepted the Terms and Conditions stated above.

Access forbidden

Your access is restricted because of your age.

I am 21 or Older I am Under 21
Shop
Wishlist
0 items Cart
My account